DEFB132 polyclonal antibody
  • DEFB132 polyclonal antibody

DEFB132 polyclonal antibody

Ref: AB-PAB24503
DEFB132 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DEFB132.
Información adicional
Size 100 uL
Gene Name DEFB132
Gene Alias DEFB32|UNQ827
Gene Description defensin, beta 132
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DEFB132.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 400830
Iso type IgG

Enviar un mensaje


DEFB132 polyclonal antibody

DEFB132 polyclonal antibody