LCE6A polyclonal antibody
  • LCE6A polyclonal antibody

LCE6A polyclonal antibody

Ref: AB-PAB24501
LCE6A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LCE6A.
Información adicional
Size 100 uL
Gene Name LCE6A
Gene Alias C1orf44
Gene Description late cornified envelope 6A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LCE6A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 448835
Iso type IgG

Enviar un mensaje


LCE6A polyclonal antibody

LCE6A polyclonal antibody