TMC2 polyclonal antibody
  • TMC2 polyclonal antibody

TMC2 polyclonal antibody

Ref: AB-PAB24497
TMC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMC2.
Información adicional
Size 100 uL
Gene Name TMC2
Gene Alias C20orf145|dJ686C3.3
Gene Description transmembrane channel-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 117532
Iso type IgG

Enviar un mensaje


TMC2 polyclonal antibody

TMC2 polyclonal antibody