ACSM1 polyclonal antibody
  • ACSM1 polyclonal antibody

ACSM1 polyclonal antibody

Ref: AB-PAB24493
ACSM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ACSM1.
Información adicional
Size 100 uL
Gene Name ACSM1
Gene Alias BUCS1|MACS1|MGC150532
Gene Description acyl-CoA synthetase medium-chain family member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ACSM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116285
Iso type IgG

Enviar un mensaje


ACSM1 polyclonal antibody

ACSM1 polyclonal antibody