GNG13 polyclonal antibody
  • GNG13 polyclonal antibody

GNG13 polyclonal antibody

Ref: AB-PAB24491
GNG13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GNG13.
Información adicional
Size 100 uL
Gene Name GNG13
Gene Alias G(gamma)13|h2-35
Gene Description guanine nucleotide binding protein (G protein), gamma 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GNG13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51764
Iso type IgG

Enviar un mensaje


GNG13 polyclonal antibody

GNG13 polyclonal antibody