Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ALDH1A3 polyclonal antibody
Abnova
ALDH1A3 polyclonal antibody
Ref: AB-PAB24490
ALDH1A3 polyclonal antibody
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against recombinant ALDH1A3.
Información adicional
Size
100 uL
Gene Name
ALDH1A3
Gene Alias
ALDH1A6|ALDH6|RALDH3
Gene Description
aldehyde dehydrogenase 1 family, member A3
Storage Conditions
Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
WB,IHC-P
Immunogen Prot. Seq
ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN
Form
Liquid
Recomended Dilution
Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Immunogen
Recombinant protein corresponding to amino acids of human ALDH1A3.
Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID
220
Iso type
IgG
Enviar un mensaje
ALDH1A3 polyclonal antibody
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*