SYT13 polyclonal antibody
  • SYT13 polyclonal antibody

SYT13 polyclonal antibody

Ref: AB-PAB24486
SYT13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYT13.
Información adicional
Size 100 uL
Gene Name SYT13
Gene Alias KIAA1427
Gene Description synaptotagmin XIII
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSAKEPSAGAGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYT13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57586
Iso type IgG

Enviar un mensaje


SYT13 polyclonal antibody

SYT13 polyclonal antibody