PRR13 polyclonal antibody
  • PRR13 polyclonal antibody

PRR13 polyclonal antibody

Ref: AB-PAB24484
PRR13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRR13.
Información adicional
Size 100 uL
Gene Name PRR13
Gene Alias DKFZp564J157|FLJ23818|TXR1
Gene Description proline rich 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRR13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54458
Iso type IgG

Enviar un mensaje


PRR13 polyclonal antibody

PRR13 polyclonal antibody