PNLIPRP3 polyclonal antibody
  • PNLIPRP3 polyclonal antibody

PNLIPRP3 polyclonal antibody

Ref: AB-PAB24482
PNLIPRP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PNLIPRP3.
Información adicional
Size 100 uL
Gene Name PNLIPRP3
Gene Alias -
Gene Description pancreatic lipase-related protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KLEPGMTYTKLIDADVNVGNITSVQFIWKKHLFEDSQNKLGAEMVINTSGKYGYKSTFCSQDIMGPNILQNLKPC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PNLIPRP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 119548
Iso type IgG

Enviar un mensaje


PNLIPRP3 polyclonal antibody

PNLIPRP3 polyclonal antibody