GDAP2 polyclonal antibody
  • GDAP2 polyclonal antibody

GDAP2 polyclonal antibody

Ref: AB-PAB24478
GDAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GDAP2.
Información adicional
Size 100 uL
Gene Name GDAP2
Gene Alias FLJ20142|dJ776P7.1
Gene Description ganglioside induced differentiation associated protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LNSSDTTAEIFQEDTVRSPFLYNKDVNGKVVLWKGDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLKGCRTGEAKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GDAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54834
Iso type IgG

Enviar un mensaje


GDAP2 polyclonal antibody

GDAP2 polyclonal antibody