C12orf43 polyclonal antibody
  • C12orf43 polyclonal antibody

C12orf43 polyclonal antibody

Ref: AB-PAB24474
C12orf43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf43.
Información adicional
Size 100 uL
Gene Name C12orf43
Gene Alias FLJ12448
Gene Description chromosome 12 open reading frame 43
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQPR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf43.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64897
Iso type IgG

Enviar un mensaje


C12orf43 polyclonal antibody

C12orf43 polyclonal antibody