C11orf68 polyclonal antibody
  • C11orf68 polyclonal antibody

C11orf68 polyclonal antibody

Ref: AB-PAB24465
C11orf68 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf68.
Información adicional
Size 100 uL
Gene Name C11orf68
Gene Alias BLES03|P5326
Gene Description chromosome 11 open reading frame 68
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AAWEALQTSGRPITPGTLRQLAITHHVLSGKWLMHLAPGFKLDHAWAGIARAVVEGQLQVAKVSPRAKEGGRQVICVYTD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf68.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83638
Iso type IgG

Enviar un mensaje


C11orf68 polyclonal antibody

C11orf68 polyclonal antibody