GABRE polyclonal antibody
  • GABRE polyclonal antibody

GABRE polyclonal antibody

Ref: AB-PAB24461
GABRE polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GABRE.
Información adicional
Size 100 uL
Gene Name GABRE
Gene Alias -
Gene Description gamma-aminobutyric acid (GABA) A receptor, epsilon
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GABRE.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2564
Iso type IgG

Enviar un mensaje


GABRE polyclonal antibody

GABRE polyclonal antibody