IFLTD1 polyclonal antibody
  • IFLTD1 polyclonal antibody

IFLTD1 polyclonal antibody

Ref: AB-PAB24460
IFLTD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IFLTD1.
Información adicional
Size 100 uL
Gene Name IFLTD1
Gene Alias FLJ36004|Pas1c1
Gene Description intermediate filament tail domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SEAKHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIHWKQAWEKLDADVEFNRCSVVSPTFRKRVFQWTASTATITKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IFLTD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 160492
Iso type IgG

Enviar un mensaje


IFLTD1 polyclonal antibody

IFLTD1 polyclonal antibody