NSUN6 polyclonal antibody
  • NSUN6 polyclonal antibody

NSUN6 polyclonal antibody

Ref: AB-PAB24458
NSUN6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NSUN6.
Información adicional
Size 100 uL
Gene Name NSUN6
Gene Alias 4933414E04Rik|FLJ23743|NOPD1
Gene Description NOL1/NOP2/Sun domain family, member 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NSUN6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221078
Iso type IgG

Enviar un mensaje


NSUN6 polyclonal antibody

NSUN6 polyclonal antibody