YEATS2 polyclonal antibody
  • YEATS2 polyclonal antibody

YEATS2 polyclonal antibody

Ref: AB-PAB24457
YEATS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant YEATS2.
Información adicional
Size 100 uL
Gene Name YEATS2
Gene Alias FLJ10201|FLJ12841|FLJ13308|KIAA1197
Gene Description YEATS domain containing 2
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLLKVSEGSKTCDTMVFNHPAIKKFLESPSRSSSPANQRAETPSANHSESDSLSQHNDFLSDKDNNSNMDIEERLSNNMEQRPSRNTGRDT
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human YEATS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55689
Iso type IgG

Enviar un mensaje


YEATS2 polyclonal antibody

YEATS2 polyclonal antibody