S100A16 polyclonal antibody
  • S100A16 polyclonal antibody

S100A16 polyclonal antibody

Ref: AB-PAB24453
S100A16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant S100A16.
Información adicional
Size 100 uL
Gene Name S100A16
Gene Alias AAG13|DT1P1A7|MGC17528|S100F
Gene Description S100 calcium binding protein A16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq VIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human S100A16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 140576
Iso type IgG

Enviar un mensaje


S100A16 polyclonal antibody

S100A16 polyclonal antibody