DCDC2B polyclonal antibody
  • DCDC2B polyclonal antibody

DCDC2B polyclonal antibody

Ref: AB-PAB24452
DCDC2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DCDC2B.
Información adicional
Size 100 uL
Gene Name DCDC2B
Gene Alias -
Gene Description doublecortin domain containing 2B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VVYRNGDPFFPGSQLVVTQRRFPTMEAFLCEVTSAVQAPLAVRALYTPCHGHPVTNLADLKNRGQYVAAGFERFHK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DCDC2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149069
Iso type IgG

Enviar un mensaje


DCDC2B polyclonal antibody

DCDC2B polyclonal antibody