RAVER2 polyclonal antibody
  • RAVER2 polyclonal antibody

RAVER2 polyclonal antibody

Ref: AB-PAB24448
RAVER2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAVER2.
Información adicional
Size 100 uL
Gene Name RAVER2
Gene Alias DKFZp762D1011|FLJ10770|KIAA1579
Gene Description ribonucleoprotein, PTB-binding 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RAVER2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55225
Iso type IgG

Enviar un mensaje


RAVER2 polyclonal antibody

RAVER2 polyclonal antibody