C10orf55 polyclonal antibody
  • C10orf55 polyclonal antibody

C10orf55 polyclonal antibody

Ref: AB-PAB24445
C10orf55 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C10orf55.
Información adicional
Size 100 uL
Gene Name C10orf55
Gene Alias bA417O11.3
Gene Description chromosome 10 open reading frame 55
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESGPAVDGI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C10orf55.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 414236
Iso type IgG

Enviar un mensaje


C10orf55 polyclonal antibody

C10orf55 polyclonal antibody