GBP3 polyclonal antibody
  • GBP3 polyclonal antibody

GBP3 polyclonal antibody

Ref: AB-PAB24438
GBP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GBP3.
Información adicional
Size 100 uL
Gene Name GBP3
Gene Alias DKFZp686E0974|DKFZp686L15228|FLJ10961
Gene Description guanylate binding protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHK
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GBP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2635
Iso type IgG

Enviar un mensaje


GBP3 polyclonal antibody

GBP3 polyclonal antibody