CCDC9 polyclonal antibody Ver mas grande

CCDC9 polyclonal antibody

AB-PAB24436

Producto nuevo

CCDC9 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name CCDC9
Gene Alias DKFZp586M1019
Gene Description coiled-coil domain containing 9
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IEEDRKKAELEGVAVTAPRKGRSVEKENVAVESEKNLGPSRRSPGTPRPPGASKGGRTPPQQGGRAGMGRASRSWE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26093
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant CCDC9.

Consulta sobre un producto

CCDC9 polyclonal antibody

CCDC9 polyclonal antibody