CCDC9 polyclonal antibody
  • CCDC9 polyclonal antibody

CCDC9 polyclonal antibody

Ref: AB-PAB24436
CCDC9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC9.
Información adicional
Size 100 uL
Gene Name CCDC9
Gene Alias DKFZp586M1019
Gene Description coiled-coil domain containing 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IEEDRKKAELEGVAVTAPRKGRSVEKENVAVESEKNLGPSRRSPGTPRPPGASKGGRTPPQQGGRAGMGRASRSWE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26093
Iso type IgG

Enviar un mensaje


CCDC9 polyclonal antibody

CCDC9 polyclonal antibody