KRCC1 polyclonal antibody
  • KRCC1 polyclonal antibody

KRCC1 polyclonal antibody

Ref: AB-PAB24435
KRCC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KRCC1.
Información adicional
Size 100 uL
Gene Name KRCC1
Gene Alias CHBP2|FLJ22333
Gene Description lysine-rich coiled-coil 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KRCC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51315
Iso type IgG

Enviar un mensaje


KRCC1 polyclonal antibody

KRCC1 polyclonal antibody