IL17REL polyclonal antibody
  • IL17REL polyclonal antibody

IL17REL polyclonal antibody

Ref: AB-PAB24423
IL17REL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IL17REL.
Información adicional
Size 100 uL
Gene Name IL17REL
Gene Alias FLJ41993
Gene Description interleukin 17 receptor E-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PVRVTANSVSQAVFLPYSQELPCLCLEGWSATPDAVRIQICPFENDTEALEVLWDTVYYHPESQTLSWEPACPVSGHVSLCWR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IL17REL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 400935
Iso type IgG

Enviar un mensaje


IL17REL polyclonal antibody

IL17REL polyclonal antibody