EIF3K polyclonal antibody
  • EIF3K polyclonal antibody

EIF3K polyclonal antibody

Ref: AB-PAB24415
EIF3K polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EIF3K.
Información adicional
Size 100 uL
Gene Name EIF3K
Gene Alias ARG134|EIF3-p28|EIF3S12|HSPC029|M9|MSTP001|PLAC-24|PLAC24|PRO1474|PTD001
Gene Description eukaryotic translation initiation factor 3, subunit K
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EIF3K.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27335
Iso type IgG

Enviar un mensaje


EIF3K polyclonal antibody

EIF3K polyclonal antibody