C5orf34 polyclonal antibody
  • C5orf34 polyclonal antibody

C5orf34 polyclonal antibody

Ref: AB-PAB24409
C5orf34 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C5orf34.
Información adicional
Size 100 uL
Gene Name C5orf34
Gene Alias FLJ32363|MGC46448
Gene Description chromosome 5 open reading frame 34
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSLSHNYRICCWKMVPGINDSNILPLVLKESLIPSVGRFLAYSDDKVHAIFLDGITLTLNWNFSSPIEKRQVNQGLNLGWCKLTFPDGQEQLIQIEHPEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C5orf34.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375444
Iso type IgG

Enviar un mensaje


C5orf34 polyclonal antibody

C5orf34 polyclonal antibody