BICC1 polyclonal antibody
  • BICC1 polyclonal antibody

BICC1 polyclonal antibody

Ref: AB-PAB24394
BICC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BICC1.
Información adicional
Size 100 uL
Gene Name BICC1
Gene Alias -
Gene Description bicaudal C homolog 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BICC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80114
Iso type IgG

Enviar un mensaje


BICC1 polyclonal antibody

BICC1 polyclonal antibody