GDF6 polyclonal antibody
  • GDF6 polyclonal antibody

GDF6 polyclonal antibody

Ref: AB-PAB24393
GDF6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GDF6.
Información adicional
Size 100 uL
Gene Name GDF6
Gene Alias BMP13|CDMP2|KFS|KFSL|MGC158100|MGC158101|SGM1
Gene Description growth differentiation factor 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IYRTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPPAGPLHVQLF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GDF6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 392255
Iso type IgG

Enviar un mensaje


GDF6 polyclonal antibody

GDF6 polyclonal antibody