BEX4 polyclonal antibody
  • BEX4 polyclonal antibody

BEX4 polyclonal antibody

Ref: AB-PAB24387
BEX4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BEX4.
Información adicional
Size 100 uL
Gene Name BEX4
Gene Alias BEXL1|FLJ10097
Gene Description brain expressed, X-linked 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDF
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BEX4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56271
Iso type IgG

Enviar un mensaje


BEX4 polyclonal antibody

BEX4 polyclonal antibody