ALG3 polyclonal antibody
  • ALG3 polyclonal antibody

ALG3 polyclonal antibody

Ref: AB-PAB24386
ALG3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ALG3.
Información adicional
Size 100 uL
Gene Name ALG3
Gene Alias CDGS4|D16Ertd36e|NOT56L|Not56
Gene Description asparagine-linked glycosylation 3, alpha-1,3- mannosyltransferase homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ALG3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10195
Iso type IgG

Enviar un mensaje


ALG3 polyclonal antibody

ALG3 polyclonal antibody