CLEC2L polyclonal antibody
  • CLEC2L polyclonal antibody

CLEC2L polyclonal antibody

Ref: AB-PAB24382
CLEC2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLEC2L.
Información adicional
Size 100 uL
Gene Name CLEC2L
Gene Alias FLJ32986
Gene Description C-type lectin domain family 2, member L
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLEC2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 154790
Iso type IgG

Enviar un mensaje


CLEC2L polyclonal antibody

CLEC2L polyclonal antibody