OR5T3 polyclonal antibody
  • OR5T3 polyclonal antibody

OR5T3 polyclonal antibody

Ref: AB-PAB24377
OR5T3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OR5T3.
Información adicional
Size 100 uL
Gene Name OR5T3
Gene Alias OR11-178|OR5T3Q
Gene Description olfactory receptor, family 5, subfamily T, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq STFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OR5T3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 390154
Iso type IgG

Enviar un mensaje


OR5T3 polyclonal antibody

OR5T3 polyclonal antibody