C2orf76 polyclonal antibody
  • C2orf76 polyclonal antibody

C2orf76 polyclonal antibody

Ref: AB-PAB24376
C2orf76 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C2orf76.
Información adicional
Size 100 uL
Gene Name C2orf76
Gene Alias AIM29|MGC104437
Gene Description chromosome 2 open reading frame 76
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDVPLRTNLPPPFRNYKYD
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C2orf76.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 130355
Iso type IgG

Enviar un mensaje


C2orf76 polyclonal antibody

C2orf76 polyclonal antibody