C6orf165 polyclonal antibody
  • C6orf165 polyclonal antibody

C6orf165 polyclonal antibody

Ref: AB-PAB24371
C6orf165 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf165.
Información adicional
Size 100 uL
Gene Name C6orf165
Gene Alias FLJ25974|dJ382I10.1
Gene Description chromosome 6 open reading frame 165
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELGTFLTLSKKDKERQLKELTMIVTGIRLFNRDCGKGGEGIDDLPAVLHVAIPATMQHIDYQLETARSQVYRYTAILEKAANDPLMRAELQPYMLKEALYNIRQYEVFLQIILSDIITGAQEVEMMTKQLGAHLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf165.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 154313
Iso type IgG

Enviar un mensaje


C6orf165 polyclonal antibody

C6orf165 polyclonal antibody