GIMAP1 polyclonal antibody
  • GIMAP1 polyclonal antibody

GIMAP1 polyclonal antibody

Ref: AB-PAB24369
GIMAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GIMAP1.
Información adicional
Size 100 uL
Gene Name GIMAP1
Gene Alias HIMAP1|IMAP1|IMAP38
Gene Description GTPase, IMAP family member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VCAFDNRATGREQEAQVEQLLGMVEGLVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GIMAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 170575
Iso type IgG

Enviar un mensaje


GIMAP1 polyclonal antibody

GIMAP1 polyclonal antibody