MXRA7 polyclonal antibody
  • MXRA7 polyclonal antibody

MXRA7 polyclonal antibody

Ref: AB-PAB24365
MXRA7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MXRA7.
Información adicional
Size 100 uL
Gene Name MXRA7
Gene Alias FLJ41492|FLJ46603|PS1TP1|TMAP1
Gene Description matrix-remodelling associated 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GPSSEGPEEEDGEGFSFKYSPGKLRGNQYKKMMTKEELEEEQRVQKEQLAAIFKLMKDNKETFGEMSDGDVQEQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MXRA7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 439921
Iso type IgG

Enviar un mensaje


MXRA7 polyclonal antibody

MXRA7 polyclonal antibody