MFSD8 polyclonal antibody
  • MFSD8 polyclonal antibody

MFSD8 polyclonal antibody

Ref: AB-PAB24363
MFSD8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MFSD8.
Información adicional
Size 100 uL
Gene Name MFSD8
Gene Alias CLN7|MGC33302
Gene Description major facilitator superfamily domain containing 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MFSD8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 256471
Iso type IgG

Enviar un mensaje


MFSD8 polyclonal antibody

MFSD8 polyclonal antibody