GSPT2 polyclonal antibody
  • GSPT2 polyclonal antibody

GSPT2 polyclonal antibody

Ref: AB-PAB24359
GSPT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GSPT2.
Información adicional
Size 100 uL
Gene Name GSPT2
Gene Alias FLJ10441|GST2|eRF3b
Gene Description G1 to S phase transition 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GSPT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23708
Iso type IgG

Enviar un mensaje


GSPT2 polyclonal antibody

GSPT2 polyclonal antibody