RNASEK polyclonal antibody
  • RNASEK polyclonal antibody

RNASEK polyclonal antibody

Ref: AB-PAB24352
RNASEK polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNASEK.
Información adicional
Size 100 uL
Gene Name RNASEK
Gene Alias MGC71993
Gene Description ribonuclease, RNase K
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SAVLIEDVPFTEKDFENGPQNIYNLYEQVS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNASEK.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 440400
Iso type IgG

Enviar un mensaje


RNASEK polyclonal antibody

RNASEK polyclonal antibody