CXorf59 polyclonal antibody
  • CXorf59 polyclonal antibody

CXorf59 polyclonal antibody

Ref: AB-PAB24349
CXorf59 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CXorf59.
Información adicional
Size 100 uL
Gene Name CXorf59
Gene Alias FLJ36601|MGC126747|MGC126749
Gene Description chromosome X open reading frame 59
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LQMTAMVEYHPDKDEDTFDRLLISIENKTTEIPLIGLIPSCQLEIESVVNFGTLVANSKVYSKEITITNHGKAPGIFKAEYHGQLPILIFPTSGIVDAKSSMVIKVDFCADQPRIVDEEAIVILQGQPEMLLSIKAHVVEQIIELLSM
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CXorf59.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 286464
Iso type IgG

Enviar un mensaje


CXorf59 polyclonal antibody

CXorf59 polyclonal antibody