C10orf129 polyclonal antibody
  • C10orf129 polyclonal antibody

C10orf129 polyclonal antibody

Ref: AB-PAB24344
C10orf129 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C10orf129.
Información adicional
Size 100 uL
Gene Name C10orf129
Gene Alias bA310E22.3
Gene Description chromosome 10 open reading frame 129
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TFCPETVLNVLSRFPITTLSANPEMYQELLQHKCFTSYRFKSLKQCVAAGGPISPGVIEDWKRITKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C10orf129.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 142827
Iso type IgG

Enviar un mensaje


C10orf129 polyclonal antibody

C10orf129 polyclonal antibody