AGXT2L1 polyclonal antibody
  • AGXT2L1 polyclonal antibody

AGXT2L1 polyclonal antibody

Ref: AB-PAB24342
AGXT2L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AGXT2L1.
Información adicional
Size 100 uL
Gene Name AGXT2L1
Gene Alias -
Gene Description alanine-glyoxylate aminotransferase 2-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AGXT2L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64850
Iso type IgG

Enviar un mensaje


AGXT2L1 polyclonal antibody

AGXT2L1 polyclonal antibody