CXXC1 polyclonal antibody
  • CXXC1 polyclonal antibody

CXXC1 polyclonal antibody

Ref: AB-PAB24339
CXXC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CXXC1.
Información adicional
Size 100 uL
Gene Name CXXC1
Gene Alias 2410002I16Rik|5830420C16Rik|CFP1|CGBP|HsT2645|PCCX1|PHF18|SPP1|hCGBP
Gene Description CXXC finger 1 (PHD domain)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VKVKHVKRREKKSEKKKEERYKRHRQKQKHKDKWKHPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILRAKQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CXXC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 30827
Iso type IgG

Enviar un mensaje


CXXC1 polyclonal antibody

CXXC1 polyclonal antibody