DNTTIP2 polyclonal antibody
  • DNTTIP2 polyclonal antibody

DNTTIP2 polyclonal antibody

Ref: AB-PAB24338
DNTTIP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNTTIP2.
Información adicional
Size 100 uL
Gene Name DNTTIP2
Gene Alias ERBP|FCF2|HSU15552|LPTS-RP2|MGC163494|RP4-561L24.1|TdIF2
Gene Description deoxynucleotidyltransferase, terminal, interacting protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PSQESHTEAISDAETSSSDISFSGIATRRTRSMQRKLKAQTEKKDSKIVPGNEKQIVGTPVNSEDSDTRQTSHLQARSLSEINKPNFYNNDFDDDFSHR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNTTIP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 30836
Iso type IgG

Enviar un mensaje


DNTTIP2 polyclonal antibody

DNTTIP2 polyclonal antibody