ZNF329 polyclonal antibody
  • ZNF329 polyclonal antibody

ZNF329 polyclonal antibody

Ref: AB-PAB24323
ZNF329 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF329.
Información adicional
Size 100 uL
Gene Name ZNF329
Gene Alias FLJ12586
Gene Description zinc finger protein 329
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EHLIASSDLPPSQRVLATNGFHAPDSNVSGLDCDPALPSYPKSYADKRTGDSDACGKGFNHSMEVIHGR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF329.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79673
Iso type IgG

Enviar un mensaje


ZNF329 polyclonal antibody

ZNF329 polyclonal antibody