ZNF623 polyclonal antibody
  • ZNF623 polyclonal antibody

ZNF623 polyclonal antibody

Ref: AB-PAB24322
ZNF623 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF623.
Información adicional
Size 100 uL
Gene Name ZNF623
Gene Alias MGC103965|MGC104128
Gene Description zinc finger protein 623
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MILLSFVSDSNVGTGEKKVTEAWISEDENSHRTTSDRLTVMELPSPESEEVHEPRLGELLGNPEGQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF623.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9831
Iso type IgG

Enviar un mensaje


ZNF623 polyclonal antibody

ZNF623 polyclonal antibody