DHX40 polyclonal antibody
  • DHX40 polyclonal antibody

DHX40 polyclonal antibody

Ref: AB-PAB24320
DHX40 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DHX40.
Información adicional
Size 100 uL
Gene Name DHX40
Gene Alias ARG147|DDX40|FLJ22060|FLJ34015|PAD
Gene Description DEAH (Asp-Glu-Ala-His) box polypeptide 40
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DHX40.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79665
Iso type IgG

Enviar un mensaje


DHX40 polyclonal antibody

DHX40 polyclonal antibody