CACNA1B polyclonal antibody
  • CACNA1B polyclonal antibody

CACNA1B polyclonal antibody

Ref: AB-PAB24318
CACNA1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CACNA1B.
Información adicional
Size 100 uL
Gene Name CACNA1B
Gene Alias BIII|CACNL1A5|CACNN|Cav2.2
Gene Description calcium channel, voltage-dependent, N type, alpha 1B subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CACNA1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 774
Iso type IgG

Enviar un mensaje


CACNA1B polyclonal antibody

CACNA1B polyclonal antibody