KIAA0664 polyclonal antibody
  • KIAA0664 polyclonal antibody

KIAA0664 polyclonal antibody

Ref: AB-PAB24317
KIAA0664 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0664.
Información adicional
Size 100 uL
Gene Name KIAA0664
Gene Alias CLU1|DKFZp686L05242|DKFZp686M09233|FLJ23672
Gene Description KIAA0664
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSHHLVARVYESKAEFRSALQHEKEGYTIYKTQLGEDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANIPPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0664.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23277
Iso type IgG

Enviar un mensaje


KIAA0664 polyclonal antibody

KIAA0664 polyclonal antibody