NELF polyclonal antibody
  • NELF polyclonal antibody

NELF polyclonal antibody

Ref: AB-PAB24313
NELF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NELF.
Información adicional
Size 100 uL
Gene Name NELF
Gene Alias MGC125369
Gene Description nasal embryonic LHRH factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NELF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26012
Iso type IgG

Enviar un mensaje


NELF polyclonal antibody

NELF polyclonal antibody